PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.14384s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YC
Protein Properties Length: 231aa    MW: 26696.3 Da    PI: 5.5056
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.14384s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC104.28.4e-3358154299
                 NF-YC   2 lksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifd 90 
                           l++fw+++  +    ++ +lPlarikk++k+d++vkm+ +++ vll+kac++fi e+tlr+w h+++++r+t++ +di++a+++++i++
  Araha.14384s0001.1.p  58 LEKFWAHHN-SIGLHEKLDLPLARIKKVMKSDPQVKMVNSDSHVLLAKACDIFIEEVTLRAWRHTQSCSRNTIQSCDIFKALKESVIYE 145
                           678887653.344456789********************************************************************** PP

                 NF-YC  91 flvdivprd 99 
                            l+d v   
  Araha.14384s0001.1.p 146 ELTDLVSFG 154
                           ****99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.65E-2060141IPR009072Histone-fold
Gene3DG3DSA:1.10.20.108.3E-2473137IPR009072Histone-fold
PfamPF008082.5E-1776138IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MVRPIVATSS VNPNPTMEES FVMMEPSEHY VNSVRQIHDQ SRFVCPTDQE RHLLNQDLEK  60
FWAHHNSIGL HEKLDLPLAR IKKVMKSDPQ VKMVNSDSHV LLAKACDIFI EEVTLRAWRH  120
TQSCSRNTIQ SCDIFKALKE SVIYEELTDL VSFGQHSVTH QGVPQDVVQQ QLFPSANVNV  180
PEMKDPIDID KIQQQCLYYR TTEHFIDIGE FELDPKYQVV FFEPLYAQQQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C1e-227615142117HapE
4g92_C1e-227615142117HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0286062e-34AB028606.1 Arabidopsis thaliana genomic DNA, chromosome 5, BAC clone:F16F17.
GenBankCP0026882e-34CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002868805.11e-148hypothetical protein ARALYDRAFT_356189
TrEMBLD7MK461e-148D7MK46_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_70033621e-148(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1910667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G38140.13e-39nuclear factor Y, subunit C12